GenomeNet

>bsu:BSU29690 K04766 acetoin utilization protein AcuA [EC:2.3.1.-] | (RefSeq) acuA; acetoin utilization protein AcuA (A)
MEHHKTYHSANIKTATGSLLIEGPVSPEDLAGYEFHKDLTAFRPPREQHEALVDIAGLPE
GRIIIARDGRTIVGYVTYLYPDPLERWSEGNMEDLIELGAIEVAPDYRGCAVGKTLLTVS
MMDEQMENYIVMTTEYYWHWDLKGMKKDVWEYRKIMEKMMNAGGLVWFATDEPEISSHPA
NCLMARIGKNVSQESIEQFDRLRFYHRYMY

BLAST