GenomeNet

>bsu:BSU33160 K02013 iron complex transport system ATP-binding protein [EC:3.6.3.34] | (RefSeq) yvrA; ABC transporter ATP-binding protein (A)
MKAEGLSGGYGDSRLINNVSLTVEKGEFLGILGPNGSGKTTLLHLLTGTLPAKKGRVYLA
GKLLADYKPKELAQIMAVLPQKMDQAFTFTVEETVAFGRYPFQTGLFRQQTEKGEAIVQE
AMEQTGVADFAQKPIRELSGGEQQRVYLAQALAQQPRILFLDEPTNFLDLAYQKDLLDLI
KRLTRESGLAAVSVFHDLNTASLYCDGLMFMKNGTAGPKQKPEYAVTEQSIKAVYDTDVT
ALVHQSSPKPMIVIQPEKDSVKRQSIPFEALLQAGRDDILLQTEIPLRTLSSTPIGAGFS
WSRTLIHKRLPDQPDPIEGLTACLSESGFQLQETCAMASSERLDRFVYRTYEDGELSVFI
CVQTGFSIWILINGYAADQFFIKALMAAEAERTKVLGDGGGTGDILIAATQTQQSENIEQ
RLNQLIKKGTAECIKEAAELFE

BLAST