GenomeNet

>bsub:BEST7613_5533 rbcS; ribulose bisphosphate carboxylase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPF
FGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY

BLAST