GenomeNet

>bsub:BEST7613_6262 tgl; transglutaminase; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIIVSGQLLRPQDIENWQIDQDLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFLKTYGNTTYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VIIYYLALIDTIGEDKFNASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILNGKQIIDKLNSFRKKGALQSAYLLSQATRLDVPSL
FRIVR

BLAST