GenomeNet

>bsub:BEST7613_6858 tdk; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEAAVVSHNG
TSMTSYAISSAADIWDHISESTDVVAVDEVQFFDQEIVEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNIMAIAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGAAESYE
ARCRHHHEVPGKSKK

BLAST