GenomeNet

>bta:100295485 ACE3; angiotensin I converting enzyme (peptidyl-dipeptidase A) 3; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MGTRWTCPGPSLLVLFCCAMAQGDQDSDQLYNETVAKAFLEFYERTAQVVWNQFMAAAWN
YVTNITKKNQEEMLYKDVEKSQHTLYFGTRARMFKIANFQDSDVKRMLSKLLNVDKAALP
KEELREYNEILAYMETTYSMAQVCLNEGPCLPLEPDLEEVMATSRDQKELLWAWQGWRDA
VGRQLRMTFERYVQLSNKAANLNGYQDMGALWRSKYESDTLQEDLEQLFQELQPLYLNLH
AYVRRSLYRFYGPELIDLRGPIPAHVLGNMWAQSWVNILDLALPFPEKPPEDITKIMQGQ
HWKPEKMFQEAEKFFTSMGLLSTPPEFWKNSMMERPTDGREVECHASAWDFYNGKDFRIK
KCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRAGANPAFEEAVGSVVTLSASSHKHLL
NRGLLSQQHQDKEEEVNFLMSVALEKIAFIPFAYLMDLFRWKVFDGTIEKDVYNQEWWNL
RLKYQGLCPPIPRTEEDFDPGAKFHISASLPYIRYFLSLVLQFQFHEALCKASGHMGPLH
RCDIYNSKEAGKLLEDVLKLGSSKPWPEVLEKMTGETKVSTKALMTYFKPLLNWLVTENV
RQGEILGWPDFSCSFEERETSRAAFLGMELNSDQVKSWQWTLLALSFVMLLAVLLLGRRL
YTMEKSSLTQDTSTQDTWSQSTRSQSPRSQDASAIKPASKICFLGIAMEPHQVVKRQWML
LGLCLLLMLCSIGLIIWIFTQHNRKPPWMRDEWGSWD

BLAST