GenomeNet

>bta:100296421 uDP glucuronosyltransferase 2 family, polypeptide B4-like; K00699 glucuronosyltransferase [EC:2.4.1.17] (A)
MNKMSMKWLLLLQLLQLTCYFSSGNCGKVLVWPVEFSHWMNMKTILDELVMRGHEVTVLQ
SSASTLIDPNKPLAMKFETFPVSLTKDDFQTLAKILIETWMLAVKDFFWIHLSTIQSLFD
EFSDIGMKICSEVVSNKKLMTKLQESRFDVVLADAVGPCGELLAEILKVPLVYSLYFSPG
YLVEKRSARLSFPPSYVPVMLSELSDHMTFMERVKNMIYVLYFDYWFQLYDEKKWNQFYS
EVVGRPTTMAELMGKAEMWLIRNYWDFSFPRPRLPNVEFVGGLHCKPAKPLPKEMEEFVQ
SSGEHGIVVFSLGSMVSNISEERANVIASALAQIPQKVLWRYDGKKPDALGPNTWLFKWI
PQNDLLGHPKTKAFITHGGSNGIYEAIYHGIPMVGLPLFADQPHNIVHMTAKGAAIRLDL
ETMSTEDLLNALKEVINNPFYKENIMRLSAIQHDQPMKPLDRAIFWIEFVMRHKGAKHLR
PASHNLTWFQYHSLDVIGFLLACVTTVVFVITKCCLFCCRKFASIGKKRKRD

BLAST