GenomeNet

>bta:282425 CYP21A2; cytochrome P450, family 21, subfamily A, polypeptide 2 (EC:1.14.99.10); K00513 steroid 21-monooxygenase [EC:1.14.99.10] (A)
MVLAGLLLLLTLLSGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLLSLTQKLGPVY
RLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAH
KKLTRSALLLGTRSSMEPWVDQLTQEFCERMRVQAGAPVTIQKEFSLLTCSIICYLTFGN
KEDTLVHAFHDCVQDLMKTWDHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQL
TRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLS
WAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAEVLRLRPVVPL
ALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQPYEFRPDRFLEPGANPSALAF
GCGARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRL
QPRGVEAGAWESASAQ

BLAST