GenomeNet

>bta:282425 K00513 steroid 21-monooxygenase [EC:1.14.14.16] | (RefSeq) CYP21A2; cytochrome P450, family 21, subfamily A, polypeptide 2 (A)
MVLAGLLLLLTLLSGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLLSLTQKLGPVY
RLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAH
KKLTRSALLLGTRSSMEPWVDQLTQEFCERMRVQAGAPVTIQKEFSLLTCSIICYLTFGN
KEDTLVHAFHDCVQDLMKTWDHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQL
TRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLS
WAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAEVLRLRPVVPL
ALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQPYEFRPDRFLEPGANPSALAF
GCGARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRL
QPRGVEAGAWESASAQ

BLAST