GenomeNet

>bta:407997 TGM1; transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase) (EC:2.3.2.13); K05619 transglutaminase 1 [EC:2.3.2.13] (A)
MPSPTPSSGGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRN
TEDDDWGPERHGDRGGRGSGSRNRRPDSRGSDSRQPGSRDSRRPGSRDSRRPGSRDSRRP
GSRGSAVNAAGDGTIREGMLVVTGVDLLSSRSDQNRREHHTDEFEYDELILRRGQPFQMV
LFLSRPYESSDHVTLELCIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLNLRVH
TSPNAIIGKFQFTIRTRCEAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLN
ESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVN
SLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGNSVPFGQCWVFAGVTTTVLRC
LGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPS
GFDGWQVVDATPQETSSGIFCCGPCSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDD
GSFKIVYVEEKAIGSLIITKAIGSNMREDITHTYKHPEGSEAERKAVETAAAHGSKPNVY
ATRDSAEDVAVQVEAQDAVMGQDLMVSVVLTNRGSSLRTVKLHLYLSVTFYTGVTGSVFK
ESKKEVVLAPGASERVTMPVAYKEYRVHLVDQGAMLLNISGHVKENGQVLAKQHTFRLRT
PDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETV
TLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGGGAFSDIRGSGRSGETIPM
ASRGGA

BLAST