GenomeNet

>bta:504652 TK1; thymidine kinase 1, soluble (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MSCINLPNVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAKDTR
YSSLFSTHDRNTMEALPACLLRDVIQDAQRVAVIGIDEGQFFPDIVEFCENMANSGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGVEKEVEVIGGADK
YHSVCRLCYFKKASGQPAVLDSEENKENCPMTLGKPAEAPGVRKLFATHQIWQCSQAN

BLAST