GenomeNet

>bta:504652 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) TK1; thymidine kinase 1 (A)
MSCINLPNVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAKDTR
YSSLFSTHDRNTMEALPACLLRDVIQDAQRVAVIGIDEGQFFPDIVEFCENMANSGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGVEKEVEVIGGADK
YHSVCRLCYFKKASGQPAVLDSEENKENCPMTLGKPAEAPGVRKLFATHQIWQCSQAN

BLAST