GenomeNet

>bta:505080 TGM3, TG(E), TGE; transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase) (EC:2.3.2.13); K05620 transglutaminase 3 [EC:2.3.2.13] (A)
MSGLQSVDWQIASNRQAHHTERFYGKDLLVRRGQLFQVSLTLSQGLSSGGRVTFTASTGP
YPSESANTKAVFPLSNGTSSSGWGAQLVSSRNNVLNISILSPANAPIGRYTLNMQISSQG
SDSTLKLGTFILLFNPWLQADSVFMSNHAEREEYVQEDAGIIFVGSTNRISMIGWNYGQF
EEGILNICLSVLDNSLNFRRDPATDVAHRNDPKYVGRVLSAMINGNDDSGVISGNWSGSY
TGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDQNLSVDVYYDPLGRPMDKGSDSVWNFHVWNEAWFVRSDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWIYESNGALKKNSADTHSVGKH
ISTKAVGSNSRMDVTEKYKYPEGSSQERQVFEKALRKLKPTMSFSATSASSLAREEREPS
ISGRFKVAGVLTVGKEVNLILMLKNLTSDTKTVTVNMTAWTIVYNGTLVHEVWKDSVTKS
LNPEEEIEHPVKIAYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDIILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGNLKIDVPALRPKERSRVRFEIL
PTRSGTKQLLANFSCNKFPAIKAMLSVDVAE

BLAST