GenomeNet

>bta:516210 CKB, B-CK; creatine kinase, brain (EC:2.7.3.2); K00933 creatine kinase [EC:2.7.3.2] (A)
MPFSNSHNTLKLRFPAEDEFPDLSGHNNHMAKVLTPELYAELRAKSTPSGFTVDDVIQTG
VDNPGHPYIMTVGCVAGDEESYDVFKELFDPIIEDRHGGYKPTDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISM
QKGGNMKEVFTRFCNGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFPEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK

BLAST