GenomeNet

>bta:526469 MAP2K4; mitogen-activated protein kinase kinase 4 (EC:2.7.1.-); K04430 mitogen-activated protein kinase kinase 4 [EC:2.7.12.2] (A)
MAAPSPSGGGGGGGGSGGGSGTPGPAGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLN
FANPPFKSTARFTLNPNPAGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGE
IGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGA
LFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIH
RDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVR
SDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLC
LTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD

BLAST