GenomeNet

>bta:526469 K04430 mitogen-activated protein kinase kinase 4 [EC:2.7.12.2] | (RefSeq) MAP2K4; mitogen-activated protein kinase kinase 4 (A)
MAAPSPSGGGGGGGGSGGGSGTPGPAGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLN
FANPPFKSTARFTLNPNPAGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGE
IGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGA
LFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIH
RDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVR
SDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLC
LTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD

BLAST