GenomeNet

>bta:531391 MAPK3, ERK1; mitogen-activated protein kinase 3 (EC:2.7.11.1); K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] (A)
MAAAAAAQGGGEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFE
HQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQ
LSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDPKALDLLDRMLTFNPNK
RITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVLE
AS

BLAST