GenomeNet

>bta:531391 K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] | (RefSeq) MAPK3, ERK1; mitogen-activated protein kinase 3 (A)
MAAAAAAQGGGEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFE
HQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQ
LSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDPKALDLLDRMLTFNPNK
RITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVLE
AS

BLAST