GenomeNet

>bta:614824 HKDC1; hexokinase domain containing 1 (EC:2.7.1.1); K00844 hexokinase [EC:2.7.1.1] (A)
MFAVHLMAFYFTKLKEDQIKKVDRFLYHMRLSDETLLDIMARFQAEMQKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSEEGKRNVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKELMQKKLPLGLTFSFPCKQTKLEEGILLSWTKKFKARGV
QGTDVVSSLTNAMKRHQDLDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCVNTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHIKGKIETRHVAAMERYKEGLANTREILTDLG
LEPSDADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLVRLRTTVGVDGTLYKIH
PQYPKRLHKVVRKLVPNCDVRFLLSESGSTKGAAMVTAVASRLQAQRKQIDKVLALFRLT
QEQLVGIRNKMRVEFEYGLKKDTHPLATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQANIDKGTLIEWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDSNCEVGLIAGTGSNMCYMEEMRNIELVEGDEGKMCINTEWGGFGDNGCLDDI
HTQYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLYGAGLAAI
VEKRREDQGLEHMRITVGVDGTLYKLHPHFSRILRETVKELAPQCDVMFMLSEDGSGKGA
ALITAVAKRLQQAQREH

BLAST