GenomeNet

>bta:617881 K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] | (RefSeq) F13A1; coagulation factor XIII A chain (EC:2.3.2.13) (A)
MSESSGTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTNVHLFKERWDS
NKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPTRDLFRVEYVIGLYPQENKGTYIPV
PLVSELQSGKWGAKVVMREDRSVRLSVQSSADCIVGKFRMYVAVWTPYGVIRTSRNPETD
TYILFNPWCEEDAVYLENEKEREECVLNDIGVIFYGDFNDIKSRSWSYGQFEDSILDACL
FVMDKANMDLSGRGNPIKVSRVGSAMINAKDDEGVIAGSWDNVYAYGVPPSAWTGSVDIL
LEYKSSQKPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQLDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLVYVTAKKDGTHVVEALDTTHIGKLIVTKEIGGDGMKDITD
TYKFQEGQEEERLALETAMMYGAKKALNTEGVLKSKSDVRMNFEVENAVLGRDLKVIITF
RNNGSARYTVTAYLSGNISFYTGVSKAEFKNKTFEVTLEPLSFKREEVLIGAGEYMGQLL
EQAFLHFFVTARVNETRDVLAKQKSIALTVPKVVIKVRGAQVVGSDMVVTVEFTNPLKET
LRNVWIRLDGPGVTKPLRKMFREIRPNSTVQWEELCRPWVSGPRKLIASLTSDSLRHVYG
ELDLQIQRRPSM

BLAST