GenomeNet

>btb:BMB171_C3628 tgl; transglutaminase; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEVYSFRTADELSFDLNLRVNIIISA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEEETFNRLFANLLLYTWDYDQDLRLITKNGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYSLNERRVPYAFISAFLTDTITRIDSR
IMSQYASSSTPQTSISFIPIRDDAIVATVGHTTTIY

BLAST