GenomeNet

>btd:BTI_2819 phosphoenolpyruvate carboxylase family protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MKSSGSARATRRNAVSSSSAPANAELPARRAAKPARKRNGAAVRTIAPTNAASAKPQGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDIVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPDQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQAGTVAYALDRLRQA
GDASPKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARELAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYADIEEALAEHGLPA
RVPAFFQMGSWIGGDRDGNPNVTATTLDEAITRQAAVIFEHYLEQVHKLGAELSASNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGAVPVRSAGRGAAP
VRATPYADAEEFVADLRVLTDSLALHHGESLATPRLAPLTRAAEVFGFHLASIDLRQSSD
IHEAVIAELLARGGVEPDYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RARAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGTPHANARNSLMAIP
LFETIADLRNASDIMREFFALPGVSELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRG
ELALVDLFHERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FSNPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEATMQALSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVAAYLDGAPDAAERGKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTADALAEITGTEARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDSNARLRRGIHLTINGIAAGLRNTG

BLAST