GenomeNet

>btd:BTI_3371 alkaline phosphatase family protein; K01077 alkaline phosphatase [EC:3.1.3.1] (A)
MSTIKRIAAAAFAAAALSGGVGQAAHAAGQAKNVIFFLGDGMGPTTVTASRLYKVGEAGQ
LTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSSDTRAIAPGSDANGN
KTVNNCVAGNGKPVSTLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQ
AVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPVANKRGRADGRNLLAELQAKGYAVVATK
DQLAQAGAAKLIGLFSTTSHLEYELDRVAGKGEGATQPSLAEMTAKAIDVLQKNPNGYFL
MVEGGRIDHALHGTNAKRALEDTAAFDEAIRTALAKVDLSNTLIVVTADHDHTMTINGYS
KRGNPVLDISRSYRDGQPNKDADGNTYTTLVFGNGANRPNVRAPVDSATATNDAYLQEVG
VRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVFGLVKSAFGF

BLAST