GenomeNet

>bte:BTH_I0877 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (GenBank) aldehyde dehydrogenase family protein (A)
MEEAKHFIAGAWAPPAGGETIAVIDPSDGEPFARLARGTAPDVDAAVRAARAAFDGPWGA
VSAAERGRALYRLSMLVAACREELALTESRDTGKPLTQARADADALARYFEFYAGAADKL
HGQTLPYRDGYTVLTLREPHGVTGHIVPWNYPMQILGRSVGAALAAGNACVVKPSEDACL
SVLRVATLAAEAGLPAGALNVVTGYGHEAGAALARHPGVDHISFTGSPDTGRLVAQMAAE
HHAPVTLELGGKSPQIVFADADLDAALPVLVSAIVQNAGQTCSAGSRVLIDKAVYEPLVE
RLATAFNGLKVGPGQADLDCGPLISAKQQRRVWDFLSDAQHDGIAMAAHGEVVPDAPETG
FYQAPALLRDVPHTHRLAQEEVFGPVLAAMKFADEDEALALANGTPYGLVAGIWTRDGAR
QMRLARKLRAGQVFVNNYGAGGGVELPFGGTGRSGYGREKGFEALYGFTVLKTIALRHG

BLAST