GenomeNet

>btg:BTB_c55320 tdk; thymidine kinase Tdk (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEDMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTNKDK

BLAST