GenomeNet

>btm:MC28_3249 sporulation stage V protein AE; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIVIGRSIVHPYITNEYEPFAAEKQQILSIMAGNQEVYSFRTADELSFDLNLRVNIIISA
LELFQSGFQFRTFQQSFCNPQFWKRTSLGGFQLLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLSLYEEETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYSLNERRVPYAFISAFLTDTITRIDSR
IMSQYASPNTPQTAIGFIPIRDDAIVATVGHTTTIY

BLAST