GenomeNet

>btn:BTF1_31242 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKVVFYYGSMNSSKSAQLIMTAFNFEQQGKNFEIVKSSQDTRDTKIKSRALSIEMDCTP
ITHFTELIQIAMLKKPDWLFVDEVQFMDKDMIDTLSHLADDFGINVIAYGLMTDFQGQLF
EGSKRLVESADSIREIKNQCIHCENKANRNVRLINNIPVFEGEVVQVGGNESYSSVCRRC
YNKIRRESKSTQKQ

BLAST