GenomeNet

>btr:Btr_1891 gst; hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MLTLFHSPLSTASRFIRLILGEYGIATQLIEEYEWARRHEFLALNPAGHVPVFLDEHEVP
LSGPFVICEYLDETHGSLRQENKLFPENPLNRAEVRRLNDWFLNKFENEATRHIVRERIH
KREMPLAIGGGAPNSQILRNARANIPPHMNYLNWLCASRDSLVGSTLSYADLAAAAAVSV
LDFLGEIDWEQSPAAKDWYMRIKSRPSFRSLLTDRVRGIVASAHYADLDF

BLAST