GenomeNet

>buj:BurJV3_2658 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase domain-containing protein (A)
MVEERVPLTVHGMSVSGNCHKVRLLLEQLGSRYRWVEVDSAHGQTHSPEFLALNPNAKVP
LIVRDDGRVLTESNAILFWLAEGTPYLPTDGWERAQALSWMFFEQYTHEPCVAVARFIRG
WTPPESPRRAELPRLHERAATALAVMERHLREAQWFTGSGYGIADIALFAYTDVAGEGGI
SLQPFPEVRAWLQRVRGQPRFLPMPAVTAEVRARFEAA

BLAST