GenomeNet

>bur:Bcep18194_A6379 glutathione S-transferase-like protein (EC:2.5.1.18); K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MKLVIGDKNYSSWSMRPWLLLAHFGIPFDEIAIELRHDDTAARIREYSPTGKVPCLVDDH
GVAIWDSLAIAETLAERYPQFPMWPADPLERAHARCVAAEMHSGFAALRTQMGMNVRASM
PGRGATPDALADVARIDALWSECLEASGGPFLFGEFGIADAMYAPVVMRFNTYAPGLSPE
AAGYAARVTALPAVQRWIDAARRETNVIAEYEPTP

BLAST