GenomeNet

>bur:Bcep18194_C7480 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase-like protein (A)
MKIISGPLSMFGAKVEIAAHEKGIDFELVMVPFSQQRGYDPRHPDVLRINPKRQVPVLID
GDLDLFDSTQIFEYLEDLKPDPALWPAHPAARAIARKLEHCSDEIYFPHVVRLMGLEETP
DDPAAQAARAEAAQYYRRMERVLADREFLAETYSYADIAFYMAQLFGARKGAPMTDETPR
LLAWRERMTARPAVRKVAGAMAAYLASIGEAVPGFLREID

BLAST