GenomeNet

>bvu:BVU_1765 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) putative alanine racemase and UDP-N-acetylmuramoylalanyl-D-glutamyl, 6-diaminopimelate-D-alanyl-D-alanyl ligase fusion protein (A)
MSSSIENIEKVLGAKRFGDRSAQIDWILTDSRSLCFPEETLFFALKTKRNDGHKYLPELY
ERGVRNFVVGELPADMKSFQDANFLQLANPLKGLQKLAEKHREQFQIPVIGITGSNGKTI
VKEWLYQLLSPDRVVTRSPRSYNSQIGVPLSVWLMNERTELAIFEAGISEMGEMEALQTI
IKPTVGILTNIGGAHQENFFSLQDKCMEKLTLFKDCDVIIYDGDNELISSCVAKSLFTSR
EIAWSKKDNERPLFIESIQKGAHATTIKYRYLGMPNEFSIPFIDDASIENSLHCLAVALY
MMVSPEQITERMARLEQIAMRLEVKEGKNGCVLINDSYNSDLASLDIALDFMSRRSDDKG
KKRTLILSDMLETGQSGKLLYRQVAELVHSRGVEKIIGVGEEIRTAAARFEIEKYFFRTT
EELLESDLLAGLRNEVILVKGSRAFHFDRISDRLELKVHETILEINLNALVDNLNYYRSK
LKPETKMVCMVKASAYGAGSYEIAKTLQDHRVDYLAVAVADEGSDLRKAGITCSIMIMNP
ELTAFKTMFDYKLEPEVYSFHLLNELIKAAEKEGVTNFPIHIKLDTGMHRLGFAPEEIPE
LIDRLKKQTAVIPRSVFSHLVGSDGAQFDSFTRRQIEMFEAASECLQEAFQHKILRHICN
TAGIERYPGAQFDMVRLGIGLYGIDPFTNQIIHNVSTLKTTILQIHEVPKEETVGYSRKG
HLERDSRIAAIPIGYADGLNRRLGNGHAYCLVNGQKAPYVGNICMDVCMIDVTDIDCKEG
DKTIIFGDDLPVTVLSEILETIPYEILTSVSNRVKRVYYQN

BLAST