GenomeNet

>bwe:BcerKBAB4_5128 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MYLMNQNGWIEVICGSMFSGKSEELIRRIRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFNHVTEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSECGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTKQR

BLAST