GenomeNet

>bxe:Bxe_B0441 RuBisCO-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSGMLQARAVDEDTLEADYLIETPLDPARVADVMAGEQSSGTFVRVANESDALRARSRAS
VLRIEELEAAARPSLPNAWLERQGTPGPWRRARITLSFPLANIDANLPTLAATVAGNLYD
LGEVTGVRLLSLRLPASYRARFELPRHGVAGTRALTDVKDRPMIGTIIKPNVGLSAAETA
ALVRELCEAGVDFIKDDEVCANPAHAPLAERVRAVMSEVRRYRERSGRPVMVAFNITDDL
DAMRRHAELVEREGGSCVMASINWCGFSAIQSLRRTTPLVLHAHRNGYGMMSRDPALGMS
FQAYQTLWRLSGVDHMHVHGLAGKFAQSDAEVIESARDCATPLAAGCDDAVLPAFSSGQW
AGTVQATFDAVRSTDLLFMSGGGILAHPDGPAAGVTSVRQAWAAVQAGTPLPVYAEHMPE
LRRALAFFGGRA

BLAST