GenomeNet

>bxe:Bxe_B2278 no KO assigned | (GenBank) Hypothetical protein (A)
MLDVTHAAVVFASERTRSSEAHRLRQFMHVSDKRLREIRTDLWRSTMKHVTRMVFASALV
MALSGGAYAQAGGGAGGGGGAAGGGGTGVGAGGGTTGGAGGTATPGVGAGSMKSPGDSGY
GTPGVTGTGGGVGTGTGASPNSPSMNRSNSGMSNGMNNGMNNGTRSGTGNGMNNGAGGTM
QNGQ

BLAST