GenomeNet

>bxh:BAXH7_02135 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD; ATP-dependent DNA ligase (A)
MVLTMQPILTSAPPTGSEWRYEVKYDGFRCLLRIDESGVTLTSRNGQTLTNQFPEITAFA
VLCFQHMKDRFPITLDGELVYLVNPYRADFEHIQIRGRLKRAEAIENIANKRPCRFLAFD
LLVLKGAATVSLPYVKRKHALFKLFEEANLPLSPRHLAEEAIQYIPEHTDFEALWDKVVR
YDGEGIVAKRVSSGWAENKRSPDWQKYKHMKTAHVLLTGFNPKNGYVTASVLKDGTAVPV
ASVSHGMQAEEKNAVRTIMETHGKKLKNGEYSLEPSICMTVQYLTILQDTLREVSFVSFQ
FGMDWTECTYQQLILRSKTLPPELQFTSLDKVVFKKREKTKEDFLCYMVKMSDVLLPFLK
DRAVTVIRYPHGAPGESFFQKNKPDYTPDFVSSVFDGSHEHIVCNSIPSLLWLANQLALE
FHVPFQTVHSKRPAEIVIDLDPPSRNDFPMAVEAAHVLKELFDSFSITSFPKLSGNKGIQ
LYIPLSPEAFTYEETRAFTMLIADYCVRTRPDLFTTERFIKNRNGRLYLDYLQHAEGKTI
IAPYSTRGNELGTVAAPLYWNEVNSSLTPDDYTIDTVVNRVRTEGDPFYEFYRNPQDGPL
SIVLEQIKRKS

BLAST