GenomeNet

>byi:BYI23_B014310 ribulose 1,5-bisphosphate carboxylase small subunit; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MHITQGTFSFLPQLTDDEISSQINYALDQGWSCSIEYTDDPHPRNTYWEMWGLPMFDLHD
AAGVLMEVNECRKTYPNHYIKVNAFDSVRGFETMRLSFMVNRPKEEQGFRLERQDNRSRI
QRYAIRTYATDRPSGERY

BLAST