GenomeNet

>byi:BYI23_C012450 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (GenBank) alpha amylase catalytic region (A)
MVNDLWYKNAVIYCLSVGVFMDANGDGVGDFQGLVRRLDYLQGLGITTIWLMPFQPSPGR
DNGYDISDYYNVDPRYGTLGDFTEFTHACRQRGLRVMIDLVVNHTSDQHPWFRQARRDPA
SKYRDWYVWSKKKPARAKEGMVFPGVQKSTWTYDKEAAMWYYHRFYDFQPDLNTANPYVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGAQVKTPVEQYDMLRMFREFLQWRQGDAII
LAEANVLPDTDMQYFGHAGERLQMMFNFQVNQNTFYALASADTTPLKKALEATKSRAATA
QWGVFLRNHDELDLGRLSPEERETVFAAFGPEPGMQLYERGIRRRLAPMLDGDRQRLELA
YSLMLTLPGTPVVRYGDEIGMGDDLRLPERESVRTPMQWSTEPHAGFTKHARPVSPVISG
GPYGYERVNVASQRRDPNSLLNWIERMIRMRKEVPEISWGDFAILRTSRDDVLALRYDWR
NNSVVCVHNFSAAACSVKFQVRVQAGESAMLVNLLSDDHSQGTAKGQHTVVLEPYGYRWF
RVGGLDYLLKRSEV

BLAST