GenomeNet

>caa:Caka_1930 K01113 alkaline phosphatase D [EC:3.1.3.1] | (GenBank) phosphodiesterase/alkaline phosphatase D-like protein (A)
MQAHRHWHIRLLLVFISVTTLNAHHPQDFTIRLDRIAFGSCNRTTLPQPLWPIIQGHAPD
LWIWAGDNVYGDSKQADVLAAEYTKQLELSAYRSFRTHTPIIGTWDDHDYGRNDAGAEFP
IKAQSRDLALNFFGVPKTDPRWGRDGLYGSYTFGPTEHQVCILLLDCRYFAEGSDLLGPD
QQHWLEASLRESKAQLNIIVSSIQVLPNEHRFEKWANFHTSHAWFLELVEALPQTNVLIL
SGDRHFHEISALQLGKHPTPLTEITSSGLTHAYTKFKGEPNQHRVGKVYAGIGFGLLTLD
WTEHKLEVTSEIRDAEDGVRLRHQITYPLVSSIQ

BLAST