GenomeNet

>cac:CA_C2887 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tdk; thymidine kinase (A)
MYRPKDHGWVEVIVGPMYSGKSEELIRRIRRAKIAKQKIQVFKPEIDNRYSKEDVVSHMG
EKEQAVAIKNSREILKYFEEDTEVIAIDEVQFFDDEIVEIVNKIAESGRRVICAGLDMDF
RGKPFGPIPELMAIAEFVDKIQAICVVCGNPATRTQRLINGKPAFYDDPVVLIGAMESYE
ARCRKCHVVPQKKEV

BLAST