GenomeNet

>cag:Cagg_1617 dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61); K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MGEITMPRLSDTMSEGTVGRWLKKVGDQIAVGDIIAEIETDKATMELEAFESGVLQQILV
PEGQTVPIGQPIAIIGDGSAPIATPPTAPPASTTPHSSPAPAPATAVASPPAISTDDNGR
IKASPVARRLAEELGIDLRQVVGTGPGGRIIKENVEEFAARRGVVTPATAPTSAPAPTPA
RAPTPAPAPTPAPARPATPVTTPAPTLAGAEPLSRMRKAIARAMNESKPGVPHIYLTIEV
DVDALMALREQIAASGTRVSVNDLVVKAAAKALAKVPAINVSFSQTADGQPGIVRHSQIN
IGVAVALDDGLVAPVVRDADKKSVSTISAEIRDMALRAREGKIKQNELEGATFQVTNLGM
FGIIEFGSIISVPQAASLAVGTVRKVPVVRDDQIVIGQVMNLTLSADHRVIDGAVGAQYL
QELRKLLESPVSIIV

BLAST