GenomeNet

>cag:Cagg_1718 alcohol dehydrogenase zinc-binding domain-containing protein; K00001 alcohol dehydrogenase [EC:1.1.1.1] (A)
MRAVYYEAFGQMPWLANLPDPTPTPDGVVLAVRATGLCRSDWHAWMGHDPDIRLPHVPGH
ELAGEVVAVGARVTRWRIGDRVTVPFVCACGVCPQCQAGQQQVCDHQFQPGFTHWGSFAE
YVAIDRADLNLVRLPDDMTYVTAASLGCRFATAFRAVVDLAKVSAGEWVAVYGCGGVGLS
AIMLAHALGGQVIGIDINPERLALARDLGAVAVVNAATEADVVGVVRELSRGGVHIAIDA
LGSPTTCANAIASLRKRGRHVQVGLLLAEQRMPPLPMDIVVARELVIMGSHGMQAHRYDA
MLDLIQSGKVQPQRLIGRTIRLDEAPVALVDLDSFRGAGVTVITEF

BLAST