GenomeNet

>cai:Caci_5867 DNA polymerase LigD, polymerase domain-containing protein (A)
MCPGVRMSVAGRSLPTMGSAEAHVEAGGRSVRISSPDKLLFPDADVTKLGLATYYAAVAD
GLFRGLANRPVALNRFPDGLGGKSFFTKSAPKGLPDWASTAHVTFPSGRTGDEVCVTEPA
TVLWTVQMGTLELHAWPVREADTDHPDELRIDLDPQPGTGFAEAVEVAREALALFEELGI
RPFVKTSGGRGLHLLVRIEPRWTFVEARRAVIALARELERRRPEMVTTSWWKEERGERIF
IDFNQMARDRMTVAPYSTRARPDAPVSMPVRWADLADVAPGDFTVKTVPDLFAKNGDANA
EIDDTAHSLDALLEMAERDEKDHGLGDMPYPPDFPKMPGEPKRVQPSKARHDQEGGS

BLAST