GenomeNet

>cal:CaO19.11420 RSM26; similar to S. cerevisiae RSM26 (YJR101W) mitochondrial ribosome small subunit protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MFNSISRGVFASSTRFTRVARFLHQVPKLESHETWTQEGIPGFLSPKGYNLAWTDYQNYL
LTNLTLLTNGTSSEYKTPYQTLLHTAKQTTQQHVFHYASMAHNNHFFFQQLDTKENASKT
KPSRFLMEKLMHEDILDLDQLRNKLLTMAENTYGQGWIFLVETEDKNLKFINCHNDGTPY
YYAKQQLLDLNGGIDEGNFSYLENLKSRALNNEKDYTLPILAINYWDYMYIPDYGVTGKS
DYLNKLWDHINWDVVNKRLFQI

BLAST