GenomeNet

>cal:CaO19.2154 NAG5; N-acetylglucosamine kinase; recognizes glucose and mannose as substrates; similar to S. cerevisiae HXK1 (YFR053C); K00844 hexokinase [EC:2.7.1.1] (A)
MTETSISGLRGPKSMYFMEIVDVSSQESSVLSSIVESFTSAVSASNLGVYSDEVLCDIKS
SLKENSPITMLPNYNVSPTGDEHGQYLVIDLGGSTLRIAVVDISKPHPNLSRSERITIVV
EKSWIIGNDFKRIDGEFFKYIGSKINEILMGQNVIDVKSVINTGITWSFPLETTDYNRGK
IKHVSKGYTVGEDIYDKDLKMVLEDTLRQEYGLTLDVQSILNDSLAVYSAGCFIDSKMKL
AMVLGTGINMCCSLKRSSDIHPSKMLADATLFNCELSLFGQNLCKDFATKYDIIIDKRFA
GFSHHFKTFMEPDPITKTLFQPHELMTSGRYLPELTRLVVVDLIEAGEIFQNVDHQQMYQ
EYGGFSGELMCFVHENDDYDDIHDKLCKAYGWTTVGLSDIVCLKEVVSCIIKRAAFIVAN
AIIAFFKLLGSDELGGDVTIGYVGSVLNYFHKYRRLIVEYVNNAEEAKGIKVDLKLIENS
SIIGAAIGAAYHK

BLAST