GenomeNet

>cal:CaO19.2154 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) NAG5; N-acetylglucosamine kinase; recognizes glucose and mannose as substrates; similar to S. cerevisiae HXK1 (YFR053C) (A)
MTETSISGLRGPKSMYFMEIVDVSSQESSVLSSIVESFTSAVSASNLGVYSDEVLCDIKS
SLKENSPITMLPNYNVSPTGDEHGQYLVIDLGGSTLRIAVVDISKPHPNLSRSERITIVV
EKSWIIGNDFKRIDGEFFKYIGSKINEILMGQNVIDVKSVINTGITWSFPLETTDYNRGK
IKHVSKGYTVGEDIYDKDLKMVLEDTLRQEYGLTLDVQSILNDSLAVYSAGCFIDSKMKL
AMVLGTGINMCCSLKRSSDIHPSKMLADATLFNCELSLFGQNLCKDFATKYDIIIDKRFA
GFSHHFKTFMEPDPITKTLFQPHELMTSGRYLPELTRLVVVDLIEAGEIFQNVDHQQMYQ
EYGGFSGELMCFVHENDDYDDIHDKLCKAYGWTTVGLSDIVCLKEVVSCIIKRAAFIVAN
AIIAFFKLLGSDELGGDVTIGYVGSVLNYFHKYRRLIVEYVNNAEEAKGIKVDLKLIENS
SIIGAAIGAAYHK

BLAST