GenomeNet

>cal:CaO19.2772 HOS3; histone deacytylase family protein similar to S. cerevisiae HOS3 (YPL116W) which acts on ribosomal RNA gene histones; K11484 histone deacetylase HOS3 [EC:3.5.1.98] (A)
MSTSKNTLSNHDNDSEDSLIEAFETTLTIRPTTTEYEDNDISIDHTTLPHTTINSINYTR
DASIVDIEELEENEQISEQIPKFKTKRRYSLLPKITAFKKTGSPGLEEYYNQQKLDPKFD
AILKPSVLLDESLIKYNHAFDEFLRSNPHIENESPRFVHDSNKTLIVLSPYSAEHAFGRK
WVTKSYLSTIFERPQRLLASCIGVASAVSMFPFYYKVINSTKRGSVFSSHVRKIHGRNWP
KKLFELCLESHEKLNNDELEVPDDWNVGDIYLTPKTINAIEGVIGTIESAVDSLFSKRKK
ENHNLAFVVIRPPGHHSHACLPSGFCLLNNVQIGIEYAFEQYGVTHCAILDIDLHHGDGS
QDICWERAGFTGDYGQQEEDEIVDPKLNPRDDYGKRFATYPKVGYFSIHDIKSYPTEIGY
ATKENIKNASTCIMDHDLNIWNVHLQEWSNEEEFYKHYQTKYVAILNRANQFLNSAKKQY
EQEYEEYLDNLGKYNKYLLKPHLYSQPLTKPTPPPPFKPLIAISAGFDASQYENPQMQRH
GINVPTSFYSTFTKDVVKLAKIHTNGKVLSFLEGGYSDGALSTGIFSHLIGLNNDDEFLW
NHSWGSQQVMKELVKGCKKNWSPYKKPQSDITIWANEVIKLGRAMMPNAILPTNYVYDDQ
TKQLNRPINKMVKELMDSRGEAVEVSSPIRKDPEDDRKVMRHTRSYYKKVSNI

BLAST