GenomeNet

>cal:CAALFM_C504530WA K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) CaO19.3938; mitochondrial 37S ribosomal protein RSM26 (A)
MFNSISRGVFASSTRFTRVARFLHQVPKLESHETWTQEGIPGFLSPKGYNLAWTDYQNYL
LTNLTLLTNGTSSEYKTPYQTLLHTAKQTTQQHVFHYASMAHNNHFFFQQLDTKENASKT
KPSRFLMEKLMHEDILDLDQLRNKLLTMAENTYGQGWIFLVETEDKNLKFINCHNDGTPY
YYAKQQLLDLNGGIDEGNFSYLENLKSRALNNEKDYTLPILAINYWDYMYIPDYGVTGKS
DYLNKLWDHINWDVVNKRLFQI

BLAST