GenomeNet

>cal:CAALFM_C300640WA K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) CaO19.5393; hypothetical protein (A)
MTIESNLESNRSEELDNLLTQLKPRLLAYIDEADPKSSNYKPESLGTFHEPKFLKQQFID
PDNDLDKPCSEEELFETIDKVLKFSVNTWNPGFLDKLYASNNPIGVISDILLSILNTNSH
VYTVSPVLSVLENYIGKKYAQLFFHNETCGGLTFSGGSWSNITSLQIARSLKYPDTKVKG
NGNYKFALYTSKHCHYSVEKGAILLGLGSENVFKVDVDENGVMDVDSLKQVIEKTKKEGY
TPLYINATAGTTVFGSYDPFLEISKVAKEHNIHFHIDGSWGGNVIFSPKYRDRLAGSEYA
DSITVNPHKMLGIPNTCSFLLLPQVANFQTAMSLKAPYLFHGRESGSDENYDLADGTMGC
GRRSDAFKFYLGWLYYGEQGFAKRVEHAYSIMEYFVQSIRSNPNFEIVGPQSPQCLQVCF
YYHPATVNKSNTEITRYVSRKLHKLGKYLVDFSPNPVDDTQGEFFRVVFNSPILSDKIVD
ELIASIISVGKELE

BLAST