GenomeNet

>cal:CaO19.6009 SET1; potential histone lysine methyltransferase, similar to S. cerevisiae SET1 (YHR119W) subunit of the COMPASS histone methyltransferase involved in telomeric and rDNA chromatin silencing; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSYNNRSGGGASGGYSRRGYHGSHRGGYRTGRSKYPEDRYLVGGMLSLNKGSHYESSDNR
YIPNEIGSKSPENRSHRSSTKDGRTPSGLSTPLSSSDKVSTPISIESINGSDRNTGVNNK
DSEFPKLSHHSDFTSTIPFSRSINPQKNFMVINDSHTPKTDKGIQSKKIRYNGEGVNHVS
DPRIAQSNSNLQKPTKKTKKTPYKQLPQPKFVYNSDSLGPAPMSTIIIWDLPISTSEPFL
RNFVSRYGNPLEEMTFITDPTTAVPLGIVTFKFQGNPQKASELAKNFIKTVRQDELKIDG
ATLKIALNDNENQLLNRKLESAKKKMLQQRLQREQEEEKRRQKLVEEQKKQELLKKKEKE
HQESVKKEKSVEHESTIVSTRDKNLVYKPNSTVLSMRHNHKIISSVILPKDLEKYIKSRP
YILIRDKYVPTKKISSHDIKRALKKYDWTRVLSDKSGFFIVFNSLNECERCFLNEDNKKF
FEYKLVMEMAIPEGFTNNIRENESKSTNDVLDEATNILIKEFQTFLAKDIRERIIAPNIL
DLLAHDKYPELVEELKSREQAAKPKVLVTNNQLKENALSILEKQRQLFQQRLPSFRMSHD
RTQQHKPKRRNSIIPMQHALNFDDDEDSESHSQSESEDEDEDETTASRPLTPVVSTMKRE
RSSTITSIEDDIELEEREIKKQKVKVPAIEAEIAPESSPEEGEEEEKEEVEIKQEAEEVD
IKFQPTEESPRTVYPEIPFSGDFDLNALQHTIKDSEDLLLAQEVLSETTPSGLSNIEYWS
WKSKNRKDVQEISQEEEYIEELPESLQSTTGSFKSEGVRKIPEIEKIGYLPHRKRTNKPI
KTIQYEDEDEEKPNENTNAVQSSRVNRANNRRFAADITAQIGSESDVLSLNALTKRKKPV
TFARSAIHNWGLYAMEPIAAKEMIIEYVGERIRQQVAEHREKSYLKTGIGSSYLFRIDDN
TVIDATKKGGIARFINHCCSPSCTAKIIKVEGKKRIVIYALRDIEANEELTYDYKFERET
NDEERIRCLCGAPGCKGYLN

BLAST