GenomeNet

>cap:CLDAP_08260 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) putative FAD-linked oxidase (A)
MAPLSWHSVDLTLDECIKCNICTSHCPVSAVTDLFPGPKYVGPQAQRFRENGQPHTPDHS
VDYCSGCRVCNEVCPTGVKIAELNARARAQIVAEKGLPLRNRLLGRNELLGKLGSFAPML
ANFGLHNPLSRLLAEKVMGIARHAPLPTWSTSGTFRDWLRRTRDQRLKSSKKVVYFHGCA
TMYYEPFIGKAAVVVLEHNGYEVIVPEQNCCGLPLLSNGEFNAARSYHRSNVGRLAGYAR
AGLPIVGTSTSCTLTLKEEAPELLDYHDEPATTLKLGTYDIFEWLRERYEAGELRTDFQP
LPLKLPYHAPCQQRAHRIGKPALELMALIPELELAESHARCCGIAGTYGYKIEKYQIAMD
VGAELFEFVKAQGKDVRYTACDSETCRWQLEHGTALPSRHPIEILAAAYGLYDLERRDVI
AGKRDRPEKR

BLAST