GenomeNet

>cbd:CBUD_1870 tuf1; protein translation elongation factor Tu (EF-TU); K02358 elongation factor Tu (A)
MSKEKFVREKPHVNVGTIGHVDHGKTTLTAALTKVLSEKYGGEKKAFDQIDNAPEERARG
ITIATSHVEYQSDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
VLAKQVGVPNIVVYLNKADMVDDKELLELVEMEVRDLLNSYDFPGDETPIIVGSALKALE
GDKSEVGEPSIIKLVETMDTYFPQPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIIK
VGDEIEIVGIKDTTKTTCTGVEMFRKLLDEGQAGDNVGILLRGTKREEVERGQVLAKPGS
ITPHKKFEAEIYVLSKEEGGRHTPFLQGYRPQFYFRTTDVTGQLLSLPEGIEMVMPGDNV
KVTVELIAPVAMDEGLRFAVREGGRTVGAGVVTKIIE

BLAST