GenomeNet

>cbe:Cbei_4338 cytidyltransferase-like protein; K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] (A)
MKTVYVAMSADIIHQGHLNVLNEARKFGDIIVGLHTDEVIRGYWRNPIMKYDERKEVISN
IKGVISVVPQESLDQVQNLLKIRPNYVLHGDDWKEGSQKELREKVIEVLKQWEGELIEVP
YTKGVSISKLDEELAKIGITPQMRMKGLKELIYSKKPLRILEAHNGLTGLIVEKTKVQRD
GKIKEFDGMWISSLCDSTAKGKPDIELVDLTSRLNTINDILEVTTKPIIVDGDTGGQIEH
FVYTVKTLERLGVSAIIIEDKTGLKKNSLFGTEVKQTQDTIEHFCDKIRAGREARVTSDF
MIISRIESLIAGAGMDDAIKRAKAYIEAGTDGIMIHSKEKDGREIIEFCRRYNEFENRVP
LVVVPTSYNFMKEEELMELGVNVIIYANHLIRSAYPAMVNTAKSILENGRSKEASINCMP
IKEILTLIPGGM

BLAST