GenomeNet

>cbg:CbuG_1769 K02358 elongation factor Tu | (GenBank) tuf2; protein translation elongation factor Tu (A)
MSKEKFVREKPHVNVGTIGHVDHGKTTLTAALTKVLSEKYGGEKKAFDQIDNAPEERARG
ITIATSHVEYQSDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
VLAKQVGVPNIVVYLNKADMVDDKELLELVEMEVRDLLNSYDFPGDETPIIVGSALKALE
GDKSEVGEPSIIKLVETMDTYFPQPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIIK
VGDEIEIVGIKDTTKTTCTGVEMFRKLLDEGQAGDNVGILLRGTKREEVERGQVLAKPGS
ITPHKKFEAEIYVLSKEEGGRHTPFLQGYRPQFYFRTTDVTGQLLSLPEGIEMVMPGDNV
KVTVELIAPVAMDEGLRFAVREGGRTVGAGVVTKIIE

BLAST