GenomeNet

>cbg:CbuG_2070 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MAKLHFYYSAMNAGKSTTLLQSSYNYNERGMDTLVFLPVVDDREGERKIATRIGLSGKAI
ALTKDTNLFKCISDKLAENPNIRCVLVDEAQFLTKSQVEALALVTDELNLPVLAYGIRTD
FQGEPFEGSVYLLALADLLIEIKTICHCGRKATMNLRIDDEGNPIREGEQIRLGGNDRYT
ATCRKHFRLGQPTQTK

BLAST